TCDB is operated by the Saier Lab Bioinformatics Group
>OGL24150.1 hypothetical protein A2791_04620 [Candidatus Saccharibacteria bacterium RIFCSPHIGHO2_01_FULL_46_30]
MNVAIVLLILLVVLFALTFFTKRRFGVLGLALTAGATLSGLWTPDVVPIVQQAGVELVAPPLSSVVAAAIILLPAVVLLF
SGPTYSSKLQRAIGALVFSLLALAFMLEPLGGALVLEGDGKRLFDILVEYRVWIITAGILLALADLLFVKTPKISKEKH