TCDB is operated by the Saier Lab Bioinformatics Group
>OGZ01012.1 hypothetical protein A3A43_03000 [Candidatus Liptonbacteria bacterium RIFCSPLOWO2_01_FULL_56_20]
MAGLIQHQSLIEQAARREVVRPKKFYAPLVLDALVVVSAFGLAGAYKGYLAGGAPLGALLAALALFAVLSVLAMLLTKAF
RRRLVVLAIEVVALFLPFYDTPVAYPFQFLTLTALAAFIVLVFGEYMGARALDNTIKIQFFRVIQPQLSRLITAMVLCGV
ILYLPYWGAQGSFLSLENFNRMFDFGIGPVKQFYPEITFTGSFGDFADAMTRLQLKNDARFRLLSPAEQERTIRDTAEQL
RVSLSASLKSDISADKPLVVVFYDFLVSMLAQWRETFGNQFLFAWAAMLFLIARSLGVVFYWASAVIAFFVYQALIAANF
IRVTGETGVHEVLDYYAPYHNNNGRIDEGRREP