TCDB is operated by the Saier Lab Bioinformatics Group
>OHA14002.1 hypothetical protein A3G49_06065 [Candidatus Sungbacteria bacterium RIFCSPLOWO2_12_FULL_41_11]
MKVDNFKQTTEISASYLRNFVFGVEDSLVSTAGLLSGIAITGMPRNSIFVAGIVLIFVEAFSMAVGSFLSERSAAEYIEK
KEVSASDSVLDGIIMFFSYFISGFIPLFPYIIMNTENAFWFSIVLSLIALFLLGVVGAKISGRNIFKSGFRMAIIGGIAI
GVGITVGRMVNNL