TCDB is operated by the Saier Lab Bioinformatics Group
>OLS15309.1 hypothetical protein RBG13Loki_1090 [Candidatus Lokiarchaeota archaeon CR_4]
MNRVATGVIVGFLFMLVAPFMFAEWEVNALMNISLGSIFLLMPTNATAAFSTWFSLGFHPDGSLFLIFGSVDWLFDPYLR
EIVWMTIMAWFSTGFLIGLIVKGWKKSTLVAIGVFIAYFAIYLILSVVSGKDLATLFSGSNLVDLFGVLLTGALFSFLGG
LSGGALGGPGEE