TCDB is operated by the Saier Lab Bioinformatics Group
>OLS18256.1 hypothetical protein OdinLCB4_14950 [Candidatus Odinarchaeota archaeon LCB_4]
MSSEKEEDLESLVSRIRVYLDISGVNEIARRYFIMNSFDGVLTSLGIIIGSASAGLINTLFIISAVLGGAIAMAISGISG
AYMAEKAERERAFKKLKKALIRDLKGSIQERALRFATFYVALVDGLAPFISPIIVLTPFLLAYLGFIQPLISLIISVVIG
FTLLFTLGAFLGRISKGNVLVSGLKMIVAGVLTVLILFVLSLL