TCDB is operated by the Saier Lab Bioinformatics Group
>OLS31039.1 hypothetical protein ThorAB25_05560 [Candidatus Thorarchaeota archaeon AB_25]
MSESEDDNNLYPTLEGGRIQRVMRALELTKGVEIARRYLAMNAFDGALTMLGLILGGLITINPALPAEANLQFNAILLAA
AGTSIAMAISGFSGSYLTESAERIREVEEMGKAMLSDMSESMYAKATKTTSVVVALVDGASPAIAAFIIIIPLFFVPGGY
LGYRIAFYIAIAICMTLLFILGLFLGAVSKQNMWAYGAKTLFAGILTAFLMFLISYFTGAAG