TCDB is operated by the Saier Lab Bioinformatics Group
>OPY17395.1 thymidylate kinase [Syntrophus sp. PtaB.Bin075]
MMTDQKTLKIVEDLCGALAEEKVDYCHWKSNEALDRSASGDNDLDLLIGRADVRKFTEILYRLDFREARSDLDGRLPGIL
NYYGFDTGTGRLIHVHAHYQMVLGSDLSKNYRIPIERAYLDSSVQTELFRVPAPEFELVIFVLRMAFKHITWDSVLLRHG
SLSPSEYRELAYLATPENLGKVGEVLRECLPYLDQDLFDACLQSLKPGCPLAKRVWTGQRLQRSLEACSRYPQALDIVSK
FSRRLWAPVQSRILRRTFKRRVTHGGLLIAIVGGDGAGKTTVIEEVHKWLGRKFDVMKLHMGKPARSRTTILGSGFLKIG
TMLGLYPATADLYAEEAEFPGYPFLIRMVFLAYDRYLTYLKARRFASNGGLVICDRYFLADLLTMDGPRCKMMAKAFNRS
NFFMNWLIRIEASCYEKMMSPDLLIVLRLNPEIAVQRKTDETAVSVRARSTSIWEYDWSKTSACVVDSSRPKEEVLAQVQ
SLIWRYL