TCDB is operated by the Saier Lab Bioinformatics Group
>OPY19905.1 VIT family protein [Methanobacterium sp. PtaU1.Bin097]
MNIRQFISDYINMSRYIALGTLDGVLAVMGVTLAASGVAGAGGVEIPNFVIGLTGLSGGIALAMSNAFGSFIGERAEEVR
SIRELEQKMMLDEGKLDDTVIHDRAKRRVYMSMFTHGFSSFIGSFVPVVPFLFLADRTSAVITTVVFCFIALIILGLYLA
RVSRENMLKICIEIVLIGVLISVVSFLIGGGH