TCDB is operated by the Saier Lab Bioinformatics Group
>OQY25394.1 hypothetical protein B6I37_01165 [Desulfobacteraceae bacterium 4572_35.2]
MMENTWPSGGLSIVSVKVTSVLAAIVLLLVIGLFHVWVRIEVTQCEYDVSRLEKKIRQAEYDQKSLTVSIAQLTNPRYIE
KVAITRLGLRAPRAEQVITVR