TCDB is operated by the Saier Lab Bioinformatics Group
>ORX42056.1 FtsX-domain-containing protein [Piromyces finnis]
MDDIKNNKINYVLKNSENTIVKEEKDGTEKKGYVKKFNNFISDVSLYTRLSIRDHKSKKGHFLIGCCSIYLVVFIVILLI
MCLKFSPIIFLVLSEQNSGEIDMDIKLPFKAPINYTKVANVIDSNLPKKYQLHTPRWKNGNAYAHNLLSCSSYNSSLNNP
IDYVVYSHKKWYQSRNYLLNDCSRNHQISTYILDMEKEKKLEICKNWNYKYPSNGKILISDTLADDLKVKVNDTIILSFS
TRDMYAVAFNEVFTNIRANIDAIIYSIPYKIEDIFSISGASCKFGSTSNNYIAIIEMTTFFQDVAEIHQKIAEMRIRDNE
LSFAEIEAYPLMFKLQTDKKYYEDVNDVVFNLPGPRSSWYLGQSFDKIAKDVIQWSSKIAWYLGFHEIYTSLDVLKEFKE
NSTMASFLNLTFTIIVLLLALLSIFLINCLMMVSVESKTHQLGIQRMVGMKRKNMIFMILVQGISYSLPGTALAFITAQV
LIIYFQPLIETTLKHSITPILSFKAVLCGIGLGLCVPIIASYFPIRKALSSNIRDSLDRRHNLNGYIITVENKFYKTIKA
NKTLIAVGGSFSLIGGLLCYFLPASLISMNIANVLTILFAVLLCMLFGMITLSLNLQPIVERIVLYIVFFINFWEKKGIS
ILTKKNLLSHRLKNKKTALMFAMSITCIIFLQSVSDVELNTMEYNARAKIGADARIYIQNIYNTGSFWLQLKAAEEYLSS
IPEVNDWAYLSDHFVYKNKNISDIKISNIGRVDPYRTHIRAISPNFFDVVSTSFGKTKFLYPTNEMTNQLTSIQTEQLYS
YEGDNRMIYPVAYKDEFVMEGKFDDKLLIKYIFSNETYCWREVQPLSYLESAPLVDMSKVMASGLSSLVSFPGMYELGKE
FYTSMKDIILQYMIISYNANITKEIKKKIKSQMLTVFNMRVNVETLDDELEFTEDVRTILNYAFSVITVAFSLIAFFSLS
NIMYMNIMEQKQEIGILRSLGVNRFSLIKIYIYEGFTILMSAGILGIIVGYILGITIMKQRTEFIHIPLSFSFPYILILV
VVGCCIVSAILATIGPLLSLSKQSQIIKLLKE