TCDB is operated by the Saier Lab Bioinformatics Group
>OXN28687.1 hypothetical protein CDV57_01388 [Aspergillus fumigatus]
MDRIWRLISRPQAYEPIEHPTGLDDDEHVSISPRPQHELPFSRYEYAVFFILGVSMLWAWNMFLAAAPYFYLRFRSDKWT
ATHFQPSILTVSTITNLGSAFILAKLQKGPSYSRRVTLSLLINIVIFSLLALSTVFVKDVDVKTYFSFLMFMVFGASLAT
GINQNGVFAYVSGFGREEYTQAIMAGQGVAGVLPCVVQIISALAVPKREGQNMPQASSKSAFMYFTTATAIAAISLVAFL
SLVRRRSVLSLQLPEEQLDSISSGYAHKTVSLWVLFKKLRYLASALFLCFAITMVYAVFTAEIEYGDVVRIGPNALVYRA
PRAWKEIYGYRTKKGQRTFQKDPSLYVPTPNGVHAIITAAESDHIRMRRLLAHAFSDRALREQESLLHFYADLLVQKLHE
NLNHSHSEVVDIARWYNFTTFDLIGDLAFGEPFQCLKDSKYHWWVSIMLDAVKLSVYLKVLWFFPILSPLTKLLVPRYLH
QRREASFQLTVEKVSRRLHRQTNRPDFISYILRHKDDENRMSRQEIDANAATFVLAGSETTAALLSGCTFYLLKNPHIYR
RLVTEIRSRFQHPSEIRLSSIATLSYLNAVLEESLRIYPPIPAMLPRLVPEEGAMINGEYVPAGETSVSMSLWSTFHSSG
NFHNPDSFIPERWLASPEEEASRCFTMDKKEAFQPFSYGPRNCLGQHLANAEMRLILAKVFWHSDMELCPESENWADQES
YNLWSRPPLMVMISRANGRNYEDNMV