TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P02719|SCNA_ELEEL Sodium channel protein OS=Electrophorus electricus PE=2 SV=1
MARKFSSARPEMFRRFTPDSLEEIEAFTELKKSCTLEKKEPESTPRIDLEAGKPLPMIYGDPPEDLLNIPLEDLDPFYKT
QKTFIVISKGNIINRFNAERALYIFSPFNPIRRGAIRVFVNSAFNFFIMFTIFSNCIFMTISNPPAWSKIVEYTFTGIYT
FEVIVKVLSRGFCIGHFTFLRDPWNWLDFSVVTMTYITEFIDLRNVSALRTFRVLRALKTITIFPGLKTIVRALIESMKQ
MGDVVILTVFSLAVFTLAGMQLFMGNLRHKCIRWPISNVTLDYESAYNTTFDFTAYIENEENQYFLDGALDALLCGNNSD
AGKCPEGYTCMKAGRNPNYGYTNYDNFAWTFLCLFRLMLQDYWENLYQMTLRAAGKSYMVFFIMVIFLGSFYLINLILAV
VAMAYEEQNQATLAEAQEKEAEFQRAVEQLRIQQEQINDERKASLASQLTQNQEAEITDDGDDAIKECNGKAFPLANIRE
PSSVKLSTEEQRSDSKSMDSKHSVDKPSLKHKAASTMSVFTLEDLEAARRPCPPVWYKFAGFVFKWNCCGPWVFLKKWVH
FVMMDPFTDLFITLCIILNTLFMSIEHHPMNESFQSLLSAGNLVFTTIFAAEMVLKIIALDPYYYFQQTWNIFDSIIVSL
SLLELGLSNMQGMSVLRSLRLLRIFKLAKSWPTLNILIKIICNSVGALGNLTIVLAIIVFIFALVGFQLFGKNYKEYVCK
ISDDCELPRWHMNDFFHSFLIVFRALCGEWIETMWDCMEVGGVPMCLAVYMMVIIIGNLVMLNLFLALLLSSFSSDNLSS
IEEDDEVNSLQVASERISRAKNWVKIFITGTVQALVLWIQGKKPPSDDVVGEEGDNEGKKDTLPLNYLDGEKIVDGITNC
VESPTLNLPIVKGESEIEEEGLVDSSDEEDTNKKKHALNDEDSSVCSTVDYSPSEQDPLAKEEEEEEEEEPEELESKDPE
ACFTEKCIWRFPFLDVDITQGKGKIWWNLRRTCYTIVEHDYFETFIIFMILLSSGVLAFEDIYIWRRRVIKVILEYADKV
FTYVFIVEMLLKWVAYGFKRYFTDAWCWLDFVIVGASIMGITSSLLGYEELGAIKNLRTIRALRPLRALSRFEGMKVVVR
ALLGAIPSIMNVLLVCLMFWLIFSIMGVNLFAGKFYRCINTTTDEILPVEEVNNRSDCMALMYTNEVRWVNLKVNYDNAG
MGYLSLLQVSTFKGWMDIMYAAVDSREVEDQPIYEINVYMYLYFVIFIVFGAFFTLNLFIGVIIDNFNRQKQKLGGEDLF
MTEEQKKYYNAMKKLGSKKAAKCIPRPSNVVQGVVYDIVTQPFTDIFIMALICINMVAMMVESEDQSQVKKDILSQINVI
FVIIFTVECLLKLLALRQYFFTVGWNVFDFAVVVISIIGLLLSDIIEKYFVSPTLFRVIRLARIARVLRLIRAAKGIRTL
LFALMMSLPALFNIGLLLFLIMFIFSIFGMSNFAYVKKQGGVDDIFNFETFGNSMICLFEITTSAGWDGLLLPTLNTGPP
DCDPDVENPGTDVRGNCGNPGKGITFFCSYIILSFLVVVNMYIAIILENFGVAQEESSDLLCEDDFVMFDETWHKFDVHG
TQFLDYNDLPRFVNALQEPMRIPNPNRHKLAKMDMYVVMEDKISYLDVLLAVTQEVLGDTTEMEAMRLSIQAKFKKDNPS
PTFFEPVVTTLRRKEEEWASVVIQRAFRQYLLMRAVSHASFLSQIKHMNEGPKDGVGSQDSLITQKMNALYRGNPELTMP
LEQQIKPMLDKPRMPSLSVPETYPIQIPKEVTNEVILHSAPMVRQNYSYSGAIVVRESIV