TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P02931|OMPF_ECOLI OUTER MEMBRANE PROTEIN F PRECURSOR (PORIN OMPF) (OUTER MEMBRANE PROTEIN 1A, IA, OR B) - Escherichia coli.
MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGY
GQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVAT
YRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGL
KYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVG
ATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF