TCDB is operated by the Saier Lab Bioinformatics Group
>P03686|VG17_BPPH2 Early protein GP17 - Bacteriophage phi-29.
MNNYQLTINEVIDIINTNTEINKLVAKKENLFPTDLYDLDKQELIAIILNSDFALSSIKRVLLEVTVEELGTQDNDEDDE
LEDLDGEIDRVDYIDKDGIRFDVPRETSPHVDKSIVTFNDELLDEANKIAKSIQEHDFNDKAIEEAELKIFKNHLPSIYS
MKKENK