TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P05306|PTSB_BACSU PTS system, sucrose-specific IIBC component (EIIBC-Scr) (Sucrose- permease IIBC component) (Phosphotransferase enzyme II, BC component) (EC 2.7.1.69) (EII-Scr) - Bacillus subtilis.
MDYKETAKRLIELLGGKENIISAAHCATRLRLVMKDESKIDQAQVEELDGVKGAFSSSGQYQIIFGTGLVNKVFDAFSKE
ADIEREEHVNHQDAAKEKLNPAARFAKTLSNIFVPIIPAIVASGLLMGLLGMINAFHWMSKDSALLQLLDMFSSAAFIFL
PILIGVSASKEFGSNPYLGAVIGGIMIHPNLLNPWGLAEATPDYMHLFGFDIALLGYQGTVIPVLLAVYVMSKVEKWTRK
VVPHAVDLLVTPFVTVIVTGFVAFIAIGPLGRALGSGITVALTYVYDHAGFVAGLIFGGTYSLIVLTGVHHSFHAIEAGL
IADIGKNYLLPIWSMANVAQGGAGLAVFFMAKKAKTKEIALPAAFSAFLGITEPVIFGVNLRYRKPFIAAMIGGALGGAY
VVFTHVAANAYGLTGIPMIAIAAPFGFSNLIHYLIGMAIAAVSAFIAAFVMKINEDEERKK