TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P05356|VIB6_AGRT9 VIRB6 protein - Agrobacterium tumefaciens.
MNFTIPAPFTAIHTIFDVAFTTGLDSMLETIQEAVSAPLIACVTLWIIVQGILVIRGEVDTRSGITRVITVTIVVALIVG
QANYQDYVVSIFEKTVPIFVQQFSVTGLPLQTVPAQLDTIFAVTQAVFQKIASEIGPMNDQDILAFQGAQWVLYGTLWSA
FGVYDAVGILTKVLLAIGPLILVGYIFDRTRDIAAKWIGQLITYGLLLLLLNLVATIVILTEATALTLMLGVITFAGTTA
AKIIGLYELDMFFLTGDALIVALPAIAGNIGGSYWSGATQSASSLYRRFAQVERG