TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P05357|VIB8_AGRT9 VIRB8 protein - Agrobacterium tumefaciens.
MLVARESLAEHYKEVEAFQTARAKSARRLSKIIAAVAAIAILGNVAQAFAIATMVPLSRLVPVYLWIRPDGTVDSEVSIS
RLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDLVSNFSAPTVRQDYQQFFNYPNPSSPQVILGKRGRVEVEHIASND
VTPSTQQIRYKRTLVVDGKMPVVSTWTATVRYEKVTSLPGRLRLTNPAGLVVTSYQTSEDTVSNVGQGAP