TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P05430|OMA_NEIGO Major outer membrane protein P.IA precursor (Protein IA) (PIA) (Class 1 protein) - Neisseria gonorrhoeae.
MKKSLIALTLAALPVAAMADVTLYGTIKAGVETSRSVAHHGAQADRVKTATEIADLGSKIGFKGQEDLGNGLKAIWQLEQ
KAYVSGTDTGWGNRQSFIGLKGGFGKVRVGRLNSVLKDTGGFNPWEGKSYYLGLSNIAQPEERHVSVRYDSPEFAGFRAV
QYVPNDNSGKNHSESYHAGFNYKNSGFFVQYAGFYKRHSYTTEKHQVHRLVGGYDHDALYASVAVQQQDAKLTWRNDNSH
NSQTEVAATAAYRFGNVTPRVSYAHGFKGSVYDADNDNTYDQVVVGAEYDFSKRTSALVSAGWLQRGKGTEKFVATVGGV
GLRHKF