TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P06550|LCTB_BACST LctB protein - Bacillus stearothermophilus.
MDYAFLGVVTAVLLGSITSLWTASVQATHRLSLDSLWVLVQWYGTMLLGFAMIYMILQANGHHVFTPSPSSAAGNRLSML
EDSLYLSGMTLLSVGYGDVTPVGIGRWIAIAEALLGYIMPAVIVTRTVFDSDRR