TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P06996|OMPC_ECOLI OUTER MEMBRANE PROTEIN C PRECURSOR (PORIN OMPC) (OUTER MEMBRANE PROTEIN 1B) - Escherichia coli.
MKVKVLSLLVPALLVAGAANAAEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQ
IQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGL
VDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAE
TYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVD
VGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF