TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P07109|HISP_ECOLI Histidine transport ATP-binding protein HisP OS=Escherichia coli (strain K12) GN=hisP PE=1 SV=2
MSENKLNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTINLVRDKDGQLK
VADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKQEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQR
VSIARALAMEPEVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLF
GNPQSPRLQRFLKGSLK