TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P07869|GRAB_BACSU Spore germination protein A2 - Bacillus subtilis.
MSQKQTPLKLNTFQGISIVANTMLGAGLLTLPRALTTKANTPDGWITLILEGFIFIFFIYLNTLIQKKHQYPSLFEYLKE
GLGKWIGSIIGLLICGYFLGVASFETRAMAEMVKFFLLERTPIQVIILTFICCGIYLMVGGLSDVSRLFPFYLTVTIIIL
LIVFGISFKIFDINNLRPVLGEGLGPIANSLTVVSISFLGMEVMLFLPEHMKKKKYTFRYASLGFLIPIILYILTYIIVV
GALTAPEVKTLIWPTISLFQSFELKGIFIERFESFLLVVWIIQFFTTFVIYGYFAANGLKKTFGLSTKTSMVIIGITVFY
FSLWPDDANQVMMYSDYLGYIFVSLFLLPFILFFIVALKRRITTK