TCDB is operated by the Saier Lab Bioinformatics Group
>P08386|VG167_BPPZA Early protein GP16.7 - Bacteriophage PZA.
MEAILMIGVITLCVIFLLSGRNNKKIQEARELEDYLEDLNQRIAQRTQILSELNEVITNRSVDKSVNMSACEIAVLDLYE
QSNIRIPSDIIEDMVNQRLQTEQDVLNYIETQRTYWKLENQKKLYRGSLK