TCDB is operated by the Saier Lab Bioinformatics Group
>P0A3V8|VIRB3_AGRTU Protein virB3 - Agrobacterium tumefaciens.
MNDRLEEATLYLAATRPALFLGVPLTLAGLFMMFAGFVIVIVQNPLYEVVLAPLWFGARLIVERDYNAASVVLLFLRTAG
RSIDSAVWGGATVSPNPIRVPPRGRGMV