TCDB is operated by the Saier Lab Bioinformatics Group
>P0A3W2|VIRB5_AGRTU Protein virB5 - Agrobacterium tumefaciens.
MKTTQLIATVLTCSFLYIQPARAQFVVSDPATEAETLATALATAENLTQTIAMVTMLTSAYGVTGLLTSLNQKNQYPSTK
DLDNEMFSPRMPMSTTARAITSDTDRAVVGSDAEADLLRSQITGSANSAGIAADNLETMDKRLTANADTSAQLSRSRNIM
QATVTNGLLLKQIHDAMIQNVQATNLLTMATAQAGLHEAEEAAAQRKEHQKTAVIFGALP