TCDB is operated by the Saier Lab Bioinformatics Group
>P0A4F8|OCCT_AGRTU Octopine-binding periplasmic protein - Agrobacterium tumefaciens.
MKLKTILCAALLLVAGQAAAQEKSITIATEGGYAPWNFSGPGGKLDGFEIDLANALCEKMKAKCQIVAQNWDGIMPSLTG
KKYDAIMAAMSVTPKRQEVIGFSIPYAAGINGFAVMGDSKLAEMPGLGETYSLDSQADAAKKAIADISSFLNGTTVGVQG
STTASTFLDKYFKGSVDIKEYKSVEEHNLDLTSGRLDAVLANATVLAAAIEKPEMKGAKLVGPLFSGGEFGVVAVGLRKE
DTALKADFDAAIKAASEDGTIKTLSLKWFKVDVTPQ