TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0A9R7|FTSE_ECOLI Cell division ATP-binding protein FtsE OS=Escherichia coli (strain K12) GN=ftsE PE=1 SV=1
MIRFEHVSKAYLGGRQALQGVTFHMQPGEMAFLTGHSGAGKSTLLKLICGIERPSAGKIWFSGHDITRLKNREVPFLRRQ
IGMIFQDHHLLMDRTVYDNVAIPLIIAGASGDDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLL
ADEPTGNLDDALSEGILRLFEEFNRVGVTVLMATHDINLISRRSYRMLTLSDGHLHGGVGHE