TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0AAP7|YAIY_ECOLI Inner membrane protein YaiY OS=Escherichia coli (strain K12) OX=83333 GN=yaiY PE=1 SV=1
MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLLVHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIP
FLVGCLIFAVVALWLHWRHRRQ