TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0AC31|FTSX_ECOL6 Cell division protein ftsX OS=Escherichia coli O6 GN=ftsX PE=3 SV=1
MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAFHGALQDLKSKPFATFLTVMV
IAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLDDDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGG
ALDMLEENPLPAVAVVIPKLDFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVI
GNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSSAVAEVAQVFGTKFDINGLSF
DECLLLLLVCSMIGWVAAWLATVQHLRHFTPE