TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0C0K2|Y246_MYCH2 Uncharacterized protein mhp246 OS=Mycoplasma hyopneumoniae (strain 232) GN=mhp246 PE=4 SV=1
MKKNFILNFATKNVKEKKLSFGVGITLWALIVFAYMIFVMNWGFASAGLNGKAGISGYLGHFFPNANEAPGTVVNQAVNW
GITIGRGIGSVLVGWLIVKISHKYTVILSLFFMLFGIIAPYSPTYAGFIILRTIFAIGGTMQIILIQPVVSNYLNQRQKA
VISQFSPFFYPIGTIITLIPFAGIIGQEAQKAFRDNWQIVFLVIGLLTLIPLIGYIILGTKFDLYPSNIEKRNKQEKLSL
ATFFKQKDTWYWTILYGSWLVAVVFPFTFSKPIFHRLIGDSDGTFNDKISVFLIFFLAGMFLGPFTIGLLSKYQLQRRKY
ISTIITLGVFFYVLATVVFVLKVGKNYEYAKSYTDGWTWLFLFLGLFMGICLWGIQGVMLNLPHEYKGSNPYRVGFQFGL
IWGLGYTAFTIATIITSLVNTPPGIDLKKLELNNVDGYALGAYILIIIFSLVSSIGLALLKEPNPEYKKLLKIRSFSEIE
RIKK