TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P10861|UCP1_BOVIN MITOCHONDRIAL BROWN FAT UNCOUPLING PROTEIN 1 (UCP 1) (THERMOGENIN) (FRAGMENT) - Bos taurus (Bovine).
IFSAGVAACVADIITFPLDTAKVRLQIQGECLISSAIRYKGVLGTIITLAKTEGPVKLYSGLPAGLQRQISLASLRIGLY
DTVQEFFTTGKEASLGSKISAGLMTGGVAVFIGQPTEVVKVRLQAQSHLHGPKPRYTGTYNAYRIIATTEGLTGLWKGTS
PNLTTNVIINCTELVTYDLMKEALVKNKLLADDVPCHFVSAVVAGFCTTVLSSPVDVVKTRFVNSSPGQNTSVPNCAMMM
LTREGPSAFFKGFVPSFLRLGSWNIMFVCFERLKQELMKCRHTMDCAT