TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P11092|CYAE_BORPE CYAE PROTEIN PRECURSOR - Bordetella pertussis.
MAAVQVRRRGRALALALWAGFALSVGGGVRARDGLATPPAFEGQAAPAVSWPCPPPADRLDDLALLEAIDLALCHSPALR
QGWARIKARSAEVGLARAPYYPSVALSAGRSAQRRSTGLGEDGVRNNVMAVTLAWRLFDSGARSAALRAAQAQLDEAAQA
YGAVLQDKLAEVVGAYYEAATARQALHTAVEDTEIARRSASIAARRARAGLDSHGDVLHAQAALERARLAQAQAEGAQAR
ALAGLAQVLGVDPATPIVLAPGPLAPQRIEDRELAQWLRDARQRHPAIKAAQAGLAAATAQVDVARATDMPTVDLSLGHY
RNSSENVSVFAGSSRSVSASLNLRIPLFDGFARRHRIQGARAEVQRQEALLDQARLATGAAVARAYADLRAARASHEASL
RWLKAARAAYESDLRRYEAGVGGVAELLRAQSDWLSARQRHVLYAAQLRTRALALLAAAGELGRSTIDGDPPKE