TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P11461|FATA_VIBAN Ferric anguibactin receptor OS=Vibrio anguillarum GN=fatA PE=3 SV=1
MTHQVATCHKKQSFSGKPTLSRIALLVALQISASALPISITHAEEQADESITVYGQANEAYAAGKISKASSIGMLGDKDF
LDTPFNAIGYTDKHIQDQHAQDISDVISASDPSVFTSGETGLNKESFKIRGFSSDIGDVMFNGLYGIAPYYRSSPEMYQR
IDVLKGPASLLNGMPPNGSVGGSINLVTKRAQEAPITSFTGTYMSDSQFGGHIDIGRRFGENEQFGVRFNGVFRDGDASV
DGQSRKAQLASLSLDWRNDIALIEADLYFSTERVDGPNRGLSIASGVDVPSPPSSDTLLSPSWAYNDSEDKGMMIRAELD
LSNSVTAYGAVGASRTDFDSNVPQRVKIIDDSGTLEVSLGSVKLESKRTSGEVGIRSSFDTGPIEHYLVLNSTYFREDKN
DSPTGNNNPGSWNPNIYNPVWGPEDSTYDNYYELPVDSTQISFGVADTLSLANGKYQVTLGLRHQSIDYESGVTWNGNAF
PTTKLKESTYTPAIVALYKVSDSVSLYGNYTEGLTNGKTAGSGAANVGEAFEPQKTKQTEAGLKLDMNDFAHTFSLFEIK
KPNGYQDPDTNIYSFGGEQRNRGIEWGFYGTVLEDYTLTGGIAYTDAEITKATDVTTEGKQATKLPDLQAKLALEWNLPV
MRQLTLIGQANYMSEQYIDAQNTQSLSAQTIFDLGARYNSTIANQSVIWRLAVNNVTDEAYWTTTHYASLALGAPRTVML
SATADF