TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P12235|ADT1_HUMAN ADP,ATP carrier protein, heart/skeletal muscle isoform T1 (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) - Homo sapiens (Human).
MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIR
YFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDC
IIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV