TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P12377|COPD_PSESM Copper resistance protein D - Pseudomonas syringae (pv. tomato).
MEDPLSIAVRFALYTDLMMLFGLALFGLYSLRGAERRSGAVLPFRPLLSATALIGLLLSVVSIVLMAKAMSGASEWLEAV
PHAEMMVTQTELGTAWLIRMAALVGAAVTIAFNLRVPMASLLMVSLLGGVALATLAWTGHGAMDEGSRRFWHFSADILHL
WSSGGWFGALVAFALMLRPNKVETLQSVQVLSRTLSGFERAGAVIVAFIVLSGVVNYLFIVGPQVSGVVESTYGVLLLGK
LALFGLMVGLASANRFVLSPAFERAVHRGEYARAARSIRYSMALELGAAVLVLGLIAWLGTLSPEMEAGM