TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P12685|TRK1_YEAST POTASSIUM TRANSPORT PROTEIN, HIGH-AFFINITY - Saccharomyces cerevisiae (Baker's yeast).
MHFRRTMSRVPTLASLEIRYKKSFGHKFRDFIALCGHYFAPVKKYIFPSFIAVHYFYTISLTLITSILLYPIKNTRYIDT
LFLAAGAVTQGGLNTVDINNLSLYQQIVLYIVCCISTPIAVHSCLAFVRLYWFERYFDGIRDSSRRNFKMRRTKTILERE
LTARTMTKNRTGTQRTSYPRKQAKTDDFQEKLFSGEMVNRDEQDSVHSDQNSHDISRDSSNNNTNHNGSSGSLDDFVKED
ETDDNGEYQENNSYSTVGSSSNTVADESLNQKPKPSSLRFDEPHSKQRPARVPSEKFAKRRGSRDISPADMYRSIMMLQG
KHEATAEDEGPPLVIGSPADGTRYKSNVNKLKKATGINGNKIKIRDKGNESNTDQNSVSSEANSTASVSDESSLHTNFGN
KVPSLRTNTHRSNSGPIAITDNAETDKKHGPSIQFDITKPPRKISKRVSTFDDLNPKSSVLYRKKASKKYLMKHFPKARR
IRQQIKRRLSTGSIEKNSSNNVSDRKPITDMDDDDDDDDNDGDNNEEYFADNESGDEDERVQQSEPHSDSELKSHQQQQE
KHQLQQNLHRMYKTKSFDDNRSRAVPMERSRTIDMAEAKDLNELARTPDFQKMVYQNWKAHHRKKPNFRKRGWNNKIFEH
GPYASDSDRNYPDNSNTGNSILHYAESILHHDGSHKNGSEEASSDSNENIYSTNGGSDHNGLNNYPTYNDDEEGYYGLHF
DTDYDLDPRHDLSKGSGKTYLSWQPTIGRNSNFLGLTRAQKDELGGVEYRAIKLLCTILVVYYVGWHIVAFVMLVPWIIL
KKHYSEVVRDDGVSPTWWGFWTAMSAFNDLGLTLTPNSMMSFNKAVYPLIVMIWFIIIGNTGFPILLRCIIWIMFKISPD
LSQMRESLGFLLDHPRRCFTLLFPKAATWWLLLTLAGLNITDWILFIILDFGSTVVKSLSKGYRVLVGLFQSVSTRTAGF
SVVDLSQLHPSIQVSYMLMMYVSVLPLAISIRRTNVYEEQSLGLYGDMGGEPEDTDTEDDGNDEDDDEENESHEGQSSQR
SSSNNNNNNNRKKKKKKKTENPNEISTKSFIGAHLRKQLSFDLWFLFLGLFIICICEGDKIKDVQEPNFNIFAILFEIVS
AYGTVGLSLGYPDTNQSFSRQFTTLSKLVIIAMLIRGKNRGLPYSLDRAIILPSDRLEHIDHLEGMKLKRQARTNTEDPM
TEHFKRSFTDVKHRWGALKRKTTHSRNPKRSSTTL