TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P13509|CZCC_ALCEU COBALT-ZINC-CADMIUM RESISTANCE PROTEIN CZCC PRECURSOR (CATION EFFLUX SYSTEM PROTEIN CZCC) - Alcaligenes eutrophus (Ralstonia eutropha).
MRRLFLPLGLAVAFLSPNFAVAQSDTGTSMVPVFPREAAGPLTLEAALSLAAGSNFNLSAAAKELDSTEGGIMQARVIPN
PELKTLVEDTRKSTRTSTAQMNIPIELGGKRSARINAAERTRELAQATLAGVRGDIRAQVIESFFSVLIAQERVKLATGS
ADIAARGAQAASRRVAAGKISPVDETKARVEQANAELELAEATASLQSARQALTALWGNASPQFAEAQGNLDALPSRPAP
ELLQKELENSPLVAASRAELDRRQALVGVERSRQYPDLTVSLGAKRDTEANRNMAVIGVAIPLPIFDRNQGNLYSAIRQA
DKAQDEYLANRISLTRNLLMASNQLSVSRASAQTLKQTVLPGAEQAFNAATIGFEAGKFNYLDVLDAQRTLFQARIRYLG
VLGQTYQAATTIDRILGR