TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P13773|CAR1_DICDI Cyclic AMP receptor 1 OS=Dictyostelium discoideum GN=carA-1 PE=1 SV=1
MGLLDGNPANETSLVLLLFADFSSMLGCMAVLIGFWRLKLLRNHVTKVIACFCATSFCKDFPSTILTLTNTAVNGGFPCY
LYAIVITYGSFACWLWTLCLAISIYMLIVKREPEPERFEKYYYLLCWGLPLISTIVMLAKNTVQFVGNWCWIGVSFTGYR
FGLFYGPFLFIWAISAVLVGLTSRYTYVVIHNGVSDNKEKHLTYQFKLINYIIVFLVCWVFAVVNRIVNGLNMFPPALNI
LHTYLSVSHGFWASVTFIYNNPLMWRYFGAKILTVFTFFGYFTDVQKKLEKNKNNNNPSPYSSSRGTSGKTMGGHPTGDD
VQCSSDMEQCSLERHPNMVNNQQNLNNNYGLQQNYNDEGSSSSSLSSSDEEKQTVEMQNIQISTSTNGQGNN