TCDB is operated by the Saier Lab Bioinformatics Group
>gnl|TC-DB|P15644 3.A.15.1.1 General secretion pathway protein D
MIIANVIRSFSLTLLIFAALLFRPAAAEEFSASFKGTDIQEFINTVSKNLNKTVIIDPSVRGTITVRSYDMLNEEQYYQF
FLSVLDVYGFAVINMNNGVLKVVRSKDAKTAAVPVASDAAPGIGDEVVTRVVPLTNVAARDLAPLLRQLNDNAGVGSVVH
YEPSNVLLMTGRAAVIKRLLTIVERVDNAGDRSVVTVPLSWASAADVVKLVTELNKDTSKSALPGSMVANVVADERTNAV
LVSGEPNSRQRIIAMIKQLDRQQATQGNTKVIYLKYAKASDLVEVLTGISSTMQSEKQAAKPVAALDKNIIIKAHGQTNA
LIVTAAPDVMNDLERVIAQLDIRRPQVLVEAIIAEVQDADGLNLGIQWANKNAGMTQFTNSGLPISTAIAGANQYNKDGT
VSSSLASALSSFNGIAAGFYQGNWAMLLTALSSSTKNDILATPSIVTLDNMEATFNVGQEVPVLTGSQTTSGDNIFNTVE
RKTVGIKLKVKPQINEGDSVLLEIEQEVSSVADAASSTSSDLGATFNTRTVNNAVLVGSGETVVVGGLLDKSVSDTADKV
PLLGDIPVIGALFRSTSKKVSKRNLMLFIRPTVIRDRDEYRQASSGQYTAFNDAQSKQRGKENNDAMLNQDLLEIYPRQD
TAAFRQVSAAIDAFNLGGNL