TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P18581|CTR2_MOUSE Low-affinity cationic amino acid transporter-2 (CAT-2) (CAT2) (TEA protein) (T-cell early activation protein) (20.5) - Mus musculus (Mouse).
MIPCRAVLTFARCLIRRKIVTLDSLEDSKLCRCLTTVDLIALGVGSTLGAGVYVLAGEVAKADSGPSIVVSFLIAALASV
MAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLNKQIGQFFKTYFKMNYTG
LAEYPDFFAVCLVLLLAGLLSFGVKESAWVNKFFTAINILVLLFVMVAGFVKGNVANWKISEEFLKNISASAREPPSENG
TSIYGAGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCFMAYFGVSAALTLMMPYYLLD
EKSPLPVAFEYVRWGPAKYVVAAGSLCALSTSLLGSMFPLPRILFAMARDGLLFRFLARVSKRQSPVAATMTAGVISAVM
AFLFDLKALVDMMSIGTLMAYSLVAACVLILRYQPGLCYEQPKYTPEKETLESCTNATLKSESQVTMLQGQGFSLRTLFS
PSALPTRQSASLVSFLVGFLAFLILGLSILTTYGVQAIARLEAWSLALLALFLVLCAAVILTIWRQPQNQQKVAFMVPFL
PFLPAFSILVNIYLMVQLSADTWIRFSIWMALGFLIYFAYGIRHSLEGNPRDEEDDEDAFSENINVATEEKSVMQANDHH
QRNLSLPFILHEKTSEC