TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P18895|ALGE_PSEAE ALGINATE PRODUCTION PROTEIN ALGE PRECURSOR - Pseudomonas aeruginosa.
MNSSRSVNPRPSFAPRALSLAIALLLGAPAFAANSGEAPKNFGLDVKITGESENDRDLGTAPGGTLNDIGIDLRPWAFGQ
WGDWSAYFMGQAVAATDTIETDTLQSDTDDGNNSRNDGREPDKSYLAAREFWVDYAGLTAYPGEHLRFGRQRLREDSGQW
QDTNIEALNWSFETTLLNAHAGVAQRFSEYRTDLDELAPEDKDRTHVFGDISTQWAPHHRIGVRIHHADDSGHLRRPGEE
VDNLDKTYTGQLTWLGIEATGDAYNYRSSMPLNYWASATWLTGDRDNLTTTTVDDRRIATGKQSGDVNAFGVDLGLRWNI
DEQWKAGVGYARGSGGGKDGEEQFQQTGLESNRSNFTGTRSRVHRFGEAFRGELSNLQAATLFGSWQLREDYDASLVYHK
FWRVDDDSDIGTSGINAALQPGEKDIGQELDLVVTKYFKQGLLPASMSQYVDEPSALIRFRGGLFKPGDAYGPGTDSTMH
RAFVDFIWRF