TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P21420|NMPC_ECOLI OUTER MEMBRANE PORIN PROTEIN NMPC PRECURSOR - Escherichia coli.
MKKLTVAISAVAASVLMAMSAQAAEIYNKDSNKLDLYGKVNAKHYFSSNDADDGDTTYARLGFKGETQINDQLTGFGQWE
YEFKGNRAESQGSSKDKTRLAFAGLKFGDYGSIDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTQRATGVATYRNN
DFFGLVDGLNFAAQYQGKNDRSDFDNYTEGNGDGFGFSATYEYEGFGIGATYAKSDRTDTQVNAGKVLPEVFASGKNAEV
WAAGLKYDANNIYLATTYSETQNMTVFADHFVANKAQNFEAVAQYQFDFGLRPSVAYLQSKGKDLGVWGDQDLVKYVDVG
ATYYFNKNMSTFVDYKINLLDKNDFTKALGVSTDDIVAVGLVYQF