TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P23596|PRTD_ERWCH Proteases secretion ATP-binding protein PrtD OS=Erwinia chrysanthemi GN=prtD PE=3 SV=1
MNASSERDRSLFGVLRQFRRSFWSVGIFSAVINVLMLAPSVYMLQVYDRVLASGNGITLLMLTLLMAGLCAFMGALEWVR
SLLVVRLGTRIDLALNQDVFNAAFARNLEAGDGRAGLALTDLTLLRQFITGNALFAFFDVPWFPLFLLVLFLLHPWLGML
ALGGTVVPGGVGLAEPASDQSTAGGSNQQSQQATHLADAQLRNADVIEAMGMLGNLRRRWLARHYRFISLQNLASERAAA
VGGASKYSRIALQSLMLGLGALLAIDGKITPGMMIAGSILVGRVLSPIDQLIGVWKQWSSARIAWQRLTRLIAAYPPRPA
AMALPAPEGHLSVEQVSLRTAQGNTRLQNIHFSLQAGETLVILGASGSGKSSLARLLVGAQSPTQGKVRLDGADLNQVDK
NTFGPTIGYLPQDVQLFKGSLAENIARFGDADPEKVVAAAKLAGVHELILSLPNGYDTELGDGGGGLSGGQRQRIGLARA
MYGDPCLLILDEPNASLDSEGDQALMQAIVALQKRGATVVLITHRPALTTLAQKILILHEGQQQRMGLARDVLTELQQRS
AANQARMNPTAAMPQ