TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P23597|PRTE_ERWCH Proteases secretion protein PrtE OS=Erwinia chrysanthemi GN=prtE PE=3 SV=1
MTGMDITTQDELNEAAMRDRASRDEERALRLGWWLVLAGFGGFLLWALLAPLDKGVAVQGNVVVSGNRKVIQHMQGGIVD
RIQVKDGDRVAAGQVLLTLNAVDARTTSEGLGSQYDQLIAREARLLAEQRNQSSLAATPRLTQARQRPEMAAIIALQEDL
LRSRQQSLKLEIDGVRASIDGLETSLGALQKVMSSKQSEQATLSQQLQGLRPLAADNYVPRNKMLETERLFAQVSGELAQ
TSGEVGRTRRDIQQQKLRIAQRQQEYDKEVNSELSDVQAKLNEVISQREKADFNLANVQVRAPVAGTVVDMKIFTEGGVI
APGQVMMDIVPEDQPLLVDGRIPVEMVDKVWSGLPVELQFTAFSQSTTPRVPGTVTLLSADRLVDEKDGTPYYGLRIQVS
EEGKRSLHGLEIKPGMPVQGFVRTGERSFINYLFKPLMDRMHLALTEE