TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P23598|PRTF_ERWCH PROTEASES SECRETION PROTEIN PRTF PRECURSOR - Erwinia chrysanthemi.
MRRKAVLLTVVLSLSGGSAQAMGLLDAWELALRNDAQLRAAGFERDAGQEEVAIGRAGLLPSLQYTYGANYSHSKVTQRD
RTLNNTTKRDYDNYVSTLTLRQPLLDYAAWARYQQGVTRKLMADQRFRDRSQDLMVRLYQSWSEALLAQEKLMLLDAQRR
AYQEQLALNRRLLAAGEGTQTDLRETEARYTVTEAQRIEQEDTLDAAMTDLENMMGSPLQIQDLSPLALDTLPDNVTENR
SLSQWRELTVRHNAKLAVQRENVDYSRYEIERNRAGHLPTLDLVASTRNSLSESEYNYNQKYDTQTVGLQVRVPLYSGGA
VSASMRQAAAEYQQSQAELDNQTRQTFAELRRQFNLCANGAAKIRAWQMSVAAAEEAIRATRQSVAGGERINLDVLMAEQ
EWYNARRELTEVKYRWLQAWLNLRYTAGTLNEQDMMQLAAWFQSAPVINKTGINAATGNKTN