TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P24126|FUSA_BURCE FUSARIC ACID RESISTANCE PROTEIN FUSA PRECURSOR - Burkholderia cepacia (Pseudomonas cepacia).
MQSPATKGTLALAVLAVSLIMAGCASMGDNKPQSARIEANALDAGAAIRAADRDAGWPAADWWRAYRDPQLDTWIAAAQA
GXPDARGRRGRVREAQAMARVARSAELPQINGNLSLMRQHWPDNVYYGPGPLANTDTWNNTGTLGLSYHLDLWGKDKNAT
ERALDTAHATAADARAAKLELEVNVVRAYVGMSMNYALLDLAHETFERQRSLADLARKRLQAGLGTQLEVSQAESTLPDY
ERQIDSYEEAIQLARHQLAALAGKGPGAGDAIKRPRLSLDAPAGLPSAMPADLLGRRPDVVAARWTVDAQARGIDVAKAS
FYPNIDLLATVGGFGVTAPFTDFLRAMNGGWTAGPALSLPIFEGGRLRAQLGAANAGVRPGGRAIQPDDRRRAQGHRRPG
RADPFARYAEEGRRTLGGRQRPQLPAVARRLPPRPDRLRQRAGRAAAIVGAHRKRPPHRSERLAAHAQLMAALGGGVETG
TDVPGSQSSHGESAAGAAAPAAASGAKPVAAAARPAQVAAAGAAGVPAAR