TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P24145|NODT_RHILT NODULATION PROTEIN T PRECURSOR - Rhizobium leguminosarum (biovar trifolii).
MRFTRYTTPFFSLLLSGCVVGPNYAPPEMPLPAKFSEGGVTSNGDVTVVAWWTAFNDPMLTSYVEQGISQNLDVQQAIER
IDLAAANVTIAEASALPDLTLSGSHTVSGQKGKLRKQTYTSNTSTGELSLSWLLDFGVYKRNTESAEAALDAAYASVDMA
KLAFINDIISSYVDARYYQRRLALSQANLKSRRETFELTKSKFAAGAVARMDVVRAEGLVQSTLAEIPSLDANFRISAHR
IATLLGKPAGSMVEEIAKGSNQPAFRADVNVGIPADIIRNRPDIRKAERDLADSTAQIGVAEAKLFPSITLSGSISPSGG
INERGVYGNLTPWSFGPKLKLPILDGGGLRADVDSAKSKATVSYLKWKSRVLNAIEQVENALVAMQREGRTVRALKREVE
IAQETLRLSTSSYKDGASSLLDLLEAQRSLSVTQASLARAVQEWAKLYAVLNIAIGSGYNPVAKAGL