TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P25747|YEIB_ECOLI Uncharacterized protein YeiB OS=Escherichia coli (strain K12) GN=yeiB PE=4 SV=2
MERNVTLDFVRGVAILGILLLNISAFGLPKAAYLNPAWYGAITPRDAWTWAFLDLIGQVKFLTLFALLFGAGLQMLLPRG
RRWIQSRLTLLVLLGFIHGLLFWDGDILLAYGLVGLICWRLVRDAPSVKSLFNTGVMLYLVGLGVLLLLGLISDSQTSRA
WTPDASAILYEKYWKLHGGVEAISNRADGVGNSLLALGAQYGWQLAGMMLIGAALMRSGWLKGQFSLRHYRRTGFVLVAI
GVTINLPAIALQWQLDWAYRWCAFLLQMPRELSAPFQAIGYASLFYGFWPQLSRFKLVLAIACVGRMALTNYLLQTLICT
TLFYHLGLFMHFDRLELLAFVIPVWLANILFSVIWLRYFRQGPVEWLWRQLTLRAAGPAISKTSR