TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P27360|VLYS_BPP21 Lysis protein S - Bacteriophage P21 (Bacteriophage 21).
MKSMDKISTGIAYGTSAGSAGYWFLQWLDQVSPSQWAAIGVLGSLVLGFLTYLTNLYFKIREDRRKAARGE