TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P27716|INX1_DROME INNEXIN INX1 (INNEXIN-1) (PROTEIN OGRE) - Drosophila melanogaster (Fruit fly).
MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISCIVNGVPPHVVNTFCWIHSTFTMPDAF
RRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITICTREEKEAKRD
ALLDYLIKHVKRHKLYAIRYWACEFLCCINIIVQMYLMNRFFDGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTF
HKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFWFWILLVLLIGLIVFRGCIIFMPKFRPRLLNASNRMIPMEICRSLSR
KLDIGDWWLIYMLGRNLDPVIYKDVMSEFAKQVEPSKHDRAK